DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43902 and Nlp

DIOPT Version :9

Sequence 1:NP_572608.2 Gene:CG43902 / 31948 FlyBaseID:FBgn0264503 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster


Alignment Length:180 Identity:43/180 - (23%)
Similarity:69/180 - (38%) Gaps:60/180 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VTLAAGNDAISAPKAGKDLQQQRHQQPSEIEDDDGARPDK------DFDFAAYVNDFNLQEEASI 92
            |||.|.:|:::     .|:            |:|.||..|      .....|..|:||: .|.:.
  Fly     9 VTLTAESDSVT-----WDV------------DEDYARGQKLVIKQILLGAEAKENEFNV-VEVNT 55

  Fly    93 PEDIFDQHDGDIGDEDIESAHIQYAPSAAAATDVE-VETE----------------DDVDDDDDV 140
            |:|          ...|..|.::...:.|...||| .|::                .::.||.:|
  Fly    56 PKD----------SVQIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEV 110

  Fly   141 RLLEEDDDASDAADIILESQRPTSRNFSVYLDAKKYQNSNNKKRSKEQKK 190
            ..:||||:..|.|: ..|.:.|..|        .|.:|:.:.|.:|..||
  Fly   111 VDMEEDDEEDDVAE-DEEDEHPKKR--------AKIENAADGKNAKNNKK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43902NP_572608.2 None
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22747
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.