DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43902 and Npm3

DIOPT Version :10

Sequence 1:NP_572608.2 Gene:CG43902 / 31948 FlyBaseID:FBgn0264503 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_032749.1 Gene:Npm3 / 18150 MGIID:894653 Length:175 Species:Mus musculus


Alignment Length:62 Identity:17/62 - (27%)
Similarity:24/62 - (38%) Gaps:10/62 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VNDFNLQEEASIPEDIFDQHDGDIGDEDIESAHIQYAPSAAAATDVEVETEDDVDDDDDVRL 142
            |:||.||     |...|....|. |...|...|    .......|:..|..||..::|:::|
Mouse   111 VDDFQLQ-----PPVTFRLKSGS-GPVRITGRH----QIVCINNDLSEEESDDESEEDEIKL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43902NP_572608.2 None
Npm3NP_032749.1 Nucleoplasmin 38..139 CDD:460792 11/37 (30%)

Return to query results.
Submit another query.