DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43902 and NPM2

DIOPT Version :10

Sequence 1:NP_572608.2 Gene:CG43902 / 31948 FlyBaseID:FBgn0264503 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_877724.1 Gene:NPM2 / 10361 HGNCID:7930 Length:214 Species:Homo sapiens


Alignment Length:224 Identity:44/224 - (19%)
Similarity:79/224 - (35%) Gaps:73/224 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KHHKSMFSKGGKIVVKLE-KPKAGNIGPVNSSHYETLRLVFRHGGE----DDFFKKYEDAV---- 126
            :.|||...  |.:.:|:. .||.|.....||...:.:    .||.|    :|...::::.:    
Human   136 RSHKSRVK--GFLRLKMAYMPKNGGQDEENSEQRDDM----EHGWEVVDSNDSASQHQEELPPPP 194

  Fly   127 ----------------------RRKTWQRSSSGSSSSGSRASSNLRSVGISGIERRLAENHQKTH 169
                                  |...|.|.|....||.|  .:|:|.:......||.......:.
Human   195 LPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSLMDVSSES--DNNIRQINQEAAHRRFRSRRHISE 257

  Fly   170 ETITQA----------FDDMSKLMETAREMVALS--------------KSISEKVRSRKGEISED 210
            :...:|          ::.:|:.|..|.:.::|:              :.:||:| ||:.:|:.|
Human   258 DLEPEASEGGGEGPEPWETISEEMNMAGDSLSLALPPPPASPVSRTSPQELSEEV-SRRLQITPD 321

  Fly   211 ---ETIAF------KSYLLSLGVSDPVTK 230
               |..:.      .|.|.|..|:|.|.:
Human   322 SNGEQFSSLIQREPSSRLRSCSVTDTVAE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43902NP_572608.2 None
NPM2NP_877724.1 Nucleoplasmin 18..121 CDD:460792
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..214 14/83 (17%)
Acidic tract A2 129..152 5/17 (29%)
Bipartite nuclear localization signal. /evidence=ECO:0000250 165..180 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.