DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43902 and NPM3

DIOPT Version :10

Sequence 1:NP_572608.2 Gene:CG43902 / 31948 FlyBaseID:FBgn0264503 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_008924.1 Gene:NPM3 / 10360 HGNCID:7931 Length:178 Species:Homo sapiens


Alignment Length:256 Identity:55/256 - (21%)
Similarity:88/256 - (34%) Gaps:97/256 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HHSLVIS----MEKHHKSMFSKGGKIVVKLEKPKAGNIGPVNSSHYETLRLVFRHGGEDDFFKKY 122
            :|:..:|    :.:|||..|....|.:..::|             ..|||   |||.|:....|.
Human   246 NHNKNVSDRFVLSEHHKKKFKDFRKDIRSVKK-------------RNTLR---RHGLENQKETKK 294

  Fly   123 EDAVRRKTWQRSSSGSSSSGSRASSNLRSVGISGIERRLAENHQKTHETITQAFDDMSKLMETAR 187
            :|    |..|||..            ||       ::...|.:.||        ||..   :|.|
Human   295 KD----KNIQRSYI------------LR-------KKNKKEGYCKT--------DDAH---DTIR 325

  Fly   188 EMVALSKSISEKVRSRKGEISEDETIAFKSYLLSLGVSDPVTKSTFVGSDSEYFQKLAKEISDVL 252
            .|:           .::|...|.:.:  |:.||:.|..:..||      |.:....|. ||.:.|
Human   326 SML-----------KKRGHYREQKEM--KNPLLTDGTKESKTK------DVKTNMNLI-EIKNAL 370

  Fly   253 YEHIKENGGMCALPEVYCRINRARGMELLSPEDVMNACGALSR---INSPLELHRFPSGVL 310
            .:            ::|..|.||:.        |...|..:.:   .|..::...||.|:|
Human   371 KK------------QIYKDIYRAQA--------VRYNCIRVDKQPVYNVEVKNSEFPRGIL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43902NP_572608.2 None
NPM3NP_008924.1 Nucleoplasmin 38..139 CDD:460792
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..178
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.