DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and RHOBTB1

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001229288.1 Gene:RHOBTB1 / 9886 HGNCID:18738 Length:696 Species:Homo sapiens


Alignment Length:199 Identity:71/199 - (35%)
Similarity:95/199 - (47%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SIKCVLVGDGAVGKTNLILSYLEN------RFNPEHIPT--ASDIY---------NADVNVNESP 439
            :||||:|||.|||||.||.:...|      :....|:||  |.|.|         :.|| |:|..
Human    14 TIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDV-VDEVS 77

  Fly   440 VHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAP--KFAKTKAALILVGT 502
            |.|.:.||.|....|  |...|..|||.:||||:..|.:...:|:.|.|  |....:..:||||.
Human    78 VSLRLWDTFGDHHKD--RRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGC 140

  Fly   503 QADLRTSP-NVLNKLQTNGEEAISYAD------AWDLATTIGAKYIETSSATQDKVKDVFDTAIW 560
            |.|||.:. ..:|:.:......|...|      ..::|..:|..|.|||...|..:|||||.||.
Human   141 QLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVFDNAIR 205

  Fly   561 EGLV 564
            ..|:
Human   206 AALI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 70/194 (36%)
RHO 395..559 CDD:197554 66/189 (35%)
RHOBTB1NP_001229288.1 Rho-like 1..210 71/199 (36%)
RhoBTB 13..207 CDD:133275 70/195 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..348
BTB <396..455 CDD:197585
BTB 476..581 CDD:306997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.