DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and RHO5

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_014219.1 Gene:RHO5 / 855541 SGDID:S000005124 Length:331 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:74/212 - (34%)
Similarity:109/212 - (51%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNV----NESPVHL---------- 442
            |||||::||||||||:|::||..|.|..:::||..|.|:..:.:    ..||:.|          
Yeast     3 SIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNGNDKRGSL 67

  Fly   443 ----------------TICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFA 491
                            .:.|||||:..|.||.||||.:|:||:||||.:..:|..:..||.|:..
Yeast    68 SSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASFANVTEKWLPELK 132

  Fly   492 KT-------------KAALILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTIG-AKYIE 542
            :|             |..::||||::|||..|....|||....:.:|..:..:|....| ..|.|
Yeast   133 QTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQEANSDYVSQEEIDELVQRCGFMGYTE 197

  Fly   543 TSSATQDKVKDVFDTAI 559
            .|:|||..|::||:.|:
Yeast   198 CSAATQAGVREVFEQAV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 73/211 (35%)
RHO 395..559 CDD:197554 70/207 (34%)
RHO5NP_014219.1 RHO 6..220 CDD:197554 71/209 (34%)
PBP1 <161..>316 CDD:227507 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.