DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and RHO4

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_012981.3 Gene:RHO4 / 853929 SGDID:S000001763 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:77/287 - (26%)
Similarity:132/287 - (45%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 GGGTGSGSGVALGVGGGPFIFGIAPEQQVTDYGSNPLPPTPPQLKQQSVISR--SPLQQSLSDTS 344
            ||..|:.|.:.  ..|.|              .|:.||.:|..|.::: :.|  :|..:|||   
Yeast    10 GGNCGNESNIV--SQGSP--------------SSSNLPESPGTLDEKN-LPRLPTPFARSLS--- 54

  Fly   345 AASSGKGSKFLLRKRKSKKTTAAAAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLI 409
                                      |..:....|:..|    .|...:|.|:|||||||||.|:
Yeast    55 --------------------------TIPSYEQMKRTNK----LPDYHLKIVVVGDGAVGKTCLL 89

  Fly   410 LSYLENRFNPEHIPTASDIYNADVNVNESP----VHLTICDTAGQDTLDPLRELCYPDSDVFLLC 470
            :||::..|..::|||..:.|..::   |.|    :.|.:.|||||:....||.|.|.::||.::|
Yeast    90 ISYVQGTFPTDYIPTIFENYVTNI---EGPNGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVC 151

  Fly   471 FSVVKPETFRAIKTKWAP--KFAKTKAALILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLA 533
            :||....:.:.::..|.|  |.......::|||.::||..:.|:.:.::.:..|:        ||
Yeast   152 YSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDLYEADNLSDLVEPSSAES--------LA 208

  Fly   534 TTIGA-KYIETSSATQDKVKDVFDTAI 559
            ..:|| .:|:.|:..::.:.:||:|||
Yeast   209 KRLGAFAHIQCSARLKENIDEVFETAI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 57/174 (33%)
RHO 395..559 CDD:197554 54/170 (32%)
RHO4NP_012981.3 Rho4_like 70..248 CDD:206704 57/177 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.