DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and ROP2

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_173437.1 Gene:ROP2 / 838598 AraportID:AT1G20090 Length:195 Species:Arabidopsis thaliana


Alignment Length:183 Identity:76/183 - (41%)
Similarity:101/183 - (55%) Gaps:19/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 IKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLR 457
            ||||.|||||||||.:::||..|.|..:::||..|.::|:|.|:.:.|:|.:.|||||:..:.||
plant     6 IKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLR 70

  Fly   458 ELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFA--KTKAALILVGTQADLRTS-------PNVL 513
            .|.|..:|||:|.||::...::..|..||.|:..  .....:|||||:.|||..       |..:
plant    71 PLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAV 135

  Fly   514 NKLQTNGEEAISYADAWDLATTIG-AKYIETSSATQDKVKDVFDTAIWEGLVP 565
            ......|||         |...|| |.|||.||.||..||.|||.||...|.|
plant   136 PITTNQGEE---------LKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 74/178 (42%)
RHO 395..559 CDD:197554 70/173 (40%)
ROP2NP_173437.1 Rop_like 5..177 CDD:206705 74/179 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.