DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and RAC10

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_201093.1 Gene:RAC10 / 836408 AraportID:AT5G62880 Length:215 Species:Arabidopsis thaliana


Alignment Length:177 Identity:77/177 - (43%)
Similarity:106/177 - (59%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 IKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLR 457
            ||||.|||||||||.:::.|..|:|..::|||..|.::|:|.|..:.|:|.:.|||||:..:.||
plant     9 IKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLR 73

  Fly   458 ELCYPDSDVFLLCFSVVKPETFRAIKTKWAPK---FAKTKAALILVGTQADLRTSPNVLNKLQTN 519
            .|.|..:|||:|.||:|...::..:..||.|:   || ....|:||||:.|||...:.|  ....
plant    74 PLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFA-PGVPLVLVGTKLDLREDKHYL--ADHP 135

  Fly   520 GEEAISYADAWDLATTIGAK-YIETSSATQDKVKDVFDTAIWEGLVP 565
            |...::.|...:|...|||. |||.||.||..||.|||:||.|.:.|
plant   136 GLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 75/172 (44%)
RHO 395..559 CDD:197554 71/167 (43%)
RAC10NP_201093.1 Rop_like 8..180 CDD:206705 76/173 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.