DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and ARAC9

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_566024.1 Gene:ARAC9 / 819077 AraportID:AT2G44690 Length:209 Species:Arabidopsis thaliana


Alignment Length:224 Identity:86/224 - (38%)
Similarity:118/224 - (52%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 TAAAAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIY 429
            :|:.|||:.::.||           ...||||.|||||||||.|::||..|.|..:::||..|.:
plant     2 SASMAATSTSSATA-----------TTFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNF 55

  Fly   430 NADVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPK---FA 491
            ||:|.|:...|:|.:.|||||:..:.:|.|.|..:|||:|.||::...:|..|..||.|:   :|
plant    56 NANVLVDGKTVNLGLWDTAGQEDYNRVRPLSYRGADVFILAFSLISRPSFENIAKKWVPELRHYA 120

  Fly   492 KTKAALILVGTQADLRTS-------PNVLNKLQTNGEEAISYADAWDLATTIGA-KYIETSSATQ 548
            .| ..::||||::|||.:       |.........|:|         |...||| .|||.||..|
plant   121 PT-VPIVLVGTKSDLRDNMQFPKNYPGACTIFPEQGQE---------LRKEIGALAYIECSSKAQ 175

  Fly   549 DKVKDVFDTAIWEGLVPTTLPPTPSFWRK 577
            ..||.|||.||...|.|      ||..:|
plant   176 MNVKAVFDEAIKVVLHP------PSKTKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 75/179 (42%)
RHO 395..559 CDD:197554 71/174 (41%)
ARAC9NP_566024.1 Rop_like 18..190 CDD:206705 75/181 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.