DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rnd3a

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_955816.1 Gene:rnd3a / 80963 ZFINID:ZDB-GENE-010319-40 Length:243 Species:Danio rerio


Alignment Length:177 Identity:60/177 - (33%)
Similarity:100/177 - (56%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 PQPSIKC--VLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQD 451
            |..|:||  |:|||...|||.|:..:.::.|...::||..:.|.|...:::..:.|::.||:|..
Zfish    18 PSQSLKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDKQRIELSLWDTSGSP 82

  Fly   452 TLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK----TKAALILVGTQADLRTSPNV 512
            ..|.:|.|.|||||..::||.:.:|||..::..||..:..:    ||  ::|||.::||||....
Zfish    83 YYDNVRPLSYPDSDAVIICFDISRPETLDSVLKKWKGEIQEFCPNTK--MLLVGCKSDLRTDLTT 145

  Fly   513 LNKLQTNGEEAISYADAWDLATTIGAKYIETSSA-TQDKVKDVFDTA 558
            |.:|..:.:..:||.....:|..|.|.|||.|:. :::.|:|:|..|
Zfish   146 LVELSNHRQTPVSYDQGSAMAKQISAPYIECSAVQSENSVRDIFHVA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 58/173 (34%)
RHO 395..559 CDD:197554 57/171 (33%)
rnd3aNP_955816.1 Rnd3_RhoE_Rho8 19..197 CDD:206735 59/176 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.