DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and cdc42l

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_956159.1 Gene:cdc42l / 793158 ZFINID:ZDB-GENE-030131-6069 Length:191 Species:Danio rerio


Alignment Length:182 Identity:83/182 - (45%)
Similarity:109/182 - (59%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPL 456
            :||||:|||||||||.|::||..|:|..|::||..|.|...|.:...|..|.:.|||||:..|.|
Zfish     3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRL 67

  Fly   457 RELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVLNKLQTN 519
            |.|.||.:||||:|||||.|.:|..:|.||.|:.:.  .:...:|||||.|||...|.:.||..|
Zfish    68 RPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLRDDSNTVEKLAKN 132

  Fly   520 GEEAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEGLVPTTLPP 570
            .:..||......|:..:.| ||:|.|:.||..:|:|||.||...|.|....|
Zfish   133 KQRPISPESGEKLSRDLRAVKYVECSALTQRGLKNVFDEAILAALEPPETKP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 80/171 (47%)
RHO 395..559 CDD:197554 76/166 (46%)
cdc42lNP_956159.1 Cdc42 3..177 CDD:206664 80/173 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.