DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rac1l

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_001332092.1 Gene:rac1l / 792699 ZFINID:ZDB-GENE-060315-6 Length:192 Species:Danio rerio


Alignment Length:193 Identity:76/193 - (39%)
Similarity:105/193 - (54%) Gaps:8/193 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPL 456
            ::|||||||.||.||.|:.||...:....::||..|..:.|:.|:.:||.|.:.|||||:....|
Zfish     3 NVKCVLVGDAAVEKTALLFSYTTGKCQDGYVPTVFDKLSVDLVVDGNPVALGLWDTAGQEDYTIL 67

  Fly   457 RELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVLNKLQTN 519
            |.|.||::||||:|||.|.|::|..:..||.|:...  ....::||||:.||:.....:..|:..
Zfish    68 RPLSYPNTDVFLVCFSCVGPQSFENVSEKWLPEVRHHCPNTPIVLVGTKLDLKNDKETIEHLKEK 132

  Fly   520 GEEAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEGLVPTTLPPTPSFWRKLFCL 581
            .:..||:......|..||| ||:|.|:.|...||.|||.||     ...|.|.....||..||
Zfish   133 KQTPISFHRGLAKAEEIGAVKYLECSAKTLKGVKTVFDEAI-----RAVLNPQEENIRKRKCL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 70/171 (41%)
RHO 395..559 CDD:197554 67/166 (40%)
rac1lXP_001332092.1 P-loop_NTPase 3..176 CDD:304359 70/177 (40%)
RHO 6..179 CDD:197554 70/177 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.