DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rhobtb3

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_082769.1 Gene:Rhobtb3 / 73296 MGIID:1920546 Length:611 Species:Mus musculus


Alignment Length:306 Identity:56/306 - (18%)
Similarity:94/306 - (30%) Gaps:115/306 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 VALGVGGGPFIFGIAPEQQVTDYGSNPLPPTPPQLKQQSVISRSPLQQSLSDTSAASSGKGSKFL 355
            ||||..|..|.....|...:..|                 :.||||          .||..|..|
Mouse     6 VALGNEGDTFHQDNRPSGLIRTY-----------------LGRSPL----------VSGDESSLL 43

  Fly   356 LRKRKSKKTTAAAAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPE 420
            |.           ||:|.|        :....:.|.|         |.|...|::          
Mouse    44 LN-----------AASTVA--------RPVFTEYQAS---------AFGNVKLVV---------- 70

  Fly   421 HIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTK 485
            |.....||:::|...:.:.:                     ..:|:.::.::|....:|..:|..
Mouse    71 HDCPVWDIFDSDWYTSRNLI---------------------GGADIIVIKYNVNDKFSFHEVKDN 114

  Fly   486 WAP--KFAKTKAALIL--VGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTIGAKYIETSS- 545
            :.|  |.|.....:|:  |||:.: ...|.......::....::..:...||..:||.|:|..| 
Mouse   115 YIPVIKRASNSVPVIIAAVGTRQN-EELPCTCPLCTSDRGSCVTTTEGIQLAKELGATYLELHSL 178

  Fly   546 -----------------------ATQDKVKDVFDTAIWEGLVPTTL 568
                                   .|.:|:|....|:.:.|:.|..|
Mouse   179 DDFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMTSSFHGIRPPQL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 30/196 (15%)
RHO 395..559 CDD:197554 30/191 (16%)
Rhobtb3NP_082769.1 Rho-like 1..175 47/255 (18%)
P-loop_NTPase 34..174 CDD:304359 36/209 (17%)
BTB 413..515 CDD:279045
Interaction with Rab9. /evidence=ECO:0000250 420..611
BTB 421..518 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.