DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rhof

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_001073389.2 Gene:Rhof / 690130 RGDID:1584038 Length:211 Species:Rattus norvegicus


Alignment Length:196 Identity:66/196 - (33%)
Similarity:103/196 - (52%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 AAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEH-IPTASDIYNA 431
            |.|...|.::|:|:           :|.|:||||..|||:|::.|.:..| ||| .|:..:.|.|
  Rat     6 APAPAAAPSSARKE-----------LKIVIVGDGGCGKTSLLMVYCQGSF-PEHYAPSVFEKYTA 58

  Fly   432 DVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPK---FAKT 493
            .|.|....|.|.:.|||||:..|.||.|.|.::.:.|:|:.|:.|.::..:..||.|:   |.: 
  Rat    59 SVTVGNKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCR- 122

  Fly   494 KAALILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTI-GAKYIETSSATQDKVKDVFDT 557
            ...::|:|.:.|||.....|.||:....|.|:|.........: ||.|:|.|:..::.|:|||..
  Rat   123 GIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYTQGLSACEQMRGALYLECSAKFRENVEDVFRE 187

  Fly   558 A 558
            |
  Rat   188 A 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 61/171 (36%)
RHO 395..559 CDD:197554 60/169 (36%)
RhofXP_001073389.2 Rho4_like 17..211 CDD:206704 62/185 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.