DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rhou

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_038954118.1 Gene:Rhou / 678766 RGDID:1596918 Length:261 Species:Rattus norvegicus


Alignment Length:283 Identity:107/283 - (37%)
Similarity:145/283 - (51%) Gaps:60/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 PPTPPQLKQQSVISRSPLQQSLSDTSAASSGKGSKFLLRKRKSKKTTAAAAATTEAATTAKKDGK 383
            ||.||:.::....:|.|         ..|.|:|              .|..|          :|:
  Rat    20 PPVPPRRERGGRGARGP---------GVSGGRG--------------RAGGA----------EGR 51

  Fly   384 KAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTA 448
                    .:|||||||||||||:|::||..|.:..|:||||.|.::|.|:|:..||.|.:||||
  Rat    52 --------GVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTA 108

  Fly   449 GQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPN 511
            |||..|.||.|||.::|:||||||||.|.:|:.:..||.|:..:  .||.:||||||:|||....
  Rat   109 GQDEFDKLRPLCYTNTDIFLLCFSVVSPTSFQNVGEKWVPEIRRHCPKAPIILVGTQSDLREDVK 173

  Fly   512 VLNKLQTNGEEAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEGLVPTTLPPTP--- 572
            ||.:|....|:.:....|...|..:.| .|||.|:.||..:|:|||.||..|:..:.....|   
  Rat   174 VLIELDKCKEKPVPEEAAKLCAEEVKAVSYIECSALTQKNLKEVFDAAIVAGIQHSDSQQQPKKS 238

  Fly   573 -------------SFWRKLFCLA 582
                         |:|||..|||
  Rat   239 KSRTPDKVRDLSKSWWRKYCCLA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 86/171 (50%)
RHO 395..559 CDD:197554 83/166 (50%)
RhouXP_038954118.1 Wrch_1 53..225 CDD:133330 86/171 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.