DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and RHOJ

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_065714.1 Gene:RHOJ / 57381 HGNCID:688 Length:214 Species:Homo sapiens


Alignment Length:170 Identity:75/170 - (44%)
Similarity:103/170 - (60%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 IKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLR 457
            :|||:|||||||||.|::||..:.|..|::||..|.|...|.|......|.:.|||||:..:.||
Human    22 LKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLR 86

  Fly   458 ELCYPDSDVFLLCFSVVKPETFRAIKTKWAP--KFAKTKAALILVGTQADLRTSPNVLNKLQTNG 520
            .|.||::||||:|||||.|.::..::.:|.|  |........:|:|||.|||..|..|.:|....
Human    87 PLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMK 151

  Fly   521 EEAISYADAWDLATTIGAK-YIETSSATQDKVKDVFDTAI 559
            |:.::|.....||..|||: |:|.|:.||..:|.|||.||
Human   152 EKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 75/170 (44%)
RHO 395..559 CDD:197554 72/166 (43%)
RHOJNP_065714.1 P-loop_NTPase 22..195 CDD:422963 75/170 (44%)
Effector region. /evidence=ECO:0000255 50..58 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.