DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rhof

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001018478.1 Gene:rhof / 573655 ZFINID:ZDB-GENE-050522-280 Length:209 Species:Danio rerio


Alignment Length:171 Identity:55/171 - (32%)
Similarity:93/171 - (54%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPL 456
            ::|.|:||||..|||:|::.|.:..|..::.|:..|.|...|:.....:.|.:.|||||:..|.|
Zfish    16 ALKIVIVGDGGCGKTSLLMVYAKGDFPEKYAPSVFDKYVTTVSYGGKDIQLNLYDTAGQEDYDRL 80

  Fly   457 RELCYPDSDVFLLCFSVVKPETFRAIKTKWAPK---FAKTKAALILVGTQADLRTSPNVLNKLQT 518
            |.|.|.|.::.|:|:.|..|.:|..:|.||.|:   |.: .|.:||:..:.|||.....:.:|:.
Zfish    81 RPLSYQDVNIVLICYDVTNPTSFDNVKIKWYPEVRHFCR-DAPIILISCKTDLRKDKEKMRRLKA 144

  Fly   519 NGEEAISYADAWDLATTIGAK-YIETSSATQDKVKDVFDTA 558
            ..:..|:|.........:.|: |:|.|:..::.|:|:|..|
Zfish   145 LDQAPITYLLGEQTQKEMNAEIYLECSAKYRENVEDIFREA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 55/170 (32%)
RHO 395..559 CDD:197554 54/168 (32%)
rhofNP_001018478.1 P-loop_NTPase 17..209 CDD:304359 55/170 (32%)
RHO 19..186 CDD:197554 54/168 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.