DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rac1b

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001034907.1 Gene:rac1b / 562838 ZFINID:ZDB-GENE-060312-45 Length:192 Species:Danio rerio


Alignment Length:189 Identity:88/189 - (46%)
Similarity:116/189 - (61%) Gaps:6/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPL 456
            :||||:|||||||||.|::||..|.|..|:|||..|.|:|:|.|:..||:|.:.|||||:..|.|
Zfish     3 AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRL 67

  Fly   457 RELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVLNKLQTN 519
            |.|.||.:||||:|||:|.|.:|..::.||.|:...  ....:|||||:.|||...:.:.||:..
Zfish    68 RPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCQTTPIILVGTKLDLRDDKDTIEKLKEK 132

  Fly   520 GEEAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEGLVPTTLPPTPSFWRK 577
            ....|:|.....:|..||| ||:|.|:.||..:|.|||.||...|.|   ||.....||
Zfish   133 KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP---PPVKKRKRK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 82/171 (48%)
RHO 395..559 CDD:197554 78/166 (47%)
rac1bNP_001034907.1 Rac1_like 3..176 CDD:206663 82/172 (48%)
RHO 6..179 CDD:197554 81/172 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.