DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rhoj

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001038266.1 Gene:rhoj / 556371 ZFINID:ZDB-GENE-040724-272 Length:226 Species:Danio rerio


Alignment Length:208 Identity:85/208 - (40%)
Similarity:117/208 - (56%) Gaps:19/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 KSKKTTAAAAA-----TTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNP 419
            ||::....||.     :....|||||           .:|||:|||||||||.|::||..:.|..
Zfish     7 KSRQNALEAAEDGGSNSDPVNTTAKK-----------MLKCVVVGDGAVGKTCLLMSYANDAFPE 60

  Fly   420 EHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKT 484
            |:|||..|.|..:|.|:.....|.:.|||||:..:.||.|.||::||||:|||||.|.::..::.
Zfish    61 EYIPTVFDHYAVNVTVSGRQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQE 125

  Fly   485 KWAPKF--AKTKAALILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTIGAK-YIETSSA 546
            :|.|:.  .......||:|||.|||..|..|.:|....|:.::|.....||..|||: |:|.|:.
Zfish   126 EWVPELRSCMPHVPYILIGTQIDLRDDPKTLARLLQMKEKPLTYEQGLKLAREIGAQCYLECSAL 190

  Fly   547 TQDKVKDVFDTAI 559
            ||..:|.|||.||
Zfish   191 TQKGLKTVFDEAI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 76/170 (45%)
RHO 395..559 CDD:197554 73/166 (44%)
rhojNP_001038266.1 P-loop_NTPase 34..207 CDD:304359 76/170 (45%)
RHO 36..209 CDD:197554 75/168 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.