Sequence 1: | NP_001036266.1 | Gene: | RhoU / 31945 | FlyBaseID: | FBgn0083940 | Length: | 582 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352487.1 | Gene: | rhobtb4 / 553415 | ZFINID: | ZDB-GENE-060315-11 | Length: | 729 | Species: | Danio rerio |
Alignment Length: | 228 | Identity: | 78/228 - (34%) |
---|---|---|---|
Similarity: | 103/228 - (45%) | Gaps: | 50/228 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 392 SIKCVLVGDGAVGKTNLILSYLEN------RFNPEHIPT--ASDIY---------NADVNVNESP 439
Fly 440 VHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAP--KFAKTKAALILVGT 502
Fly 503 QADLRTSP-NVLNKLQTNGEEAISYAD------AWDLATTIGAKYIETSSATQDKVKDVFDTAI- 559
Fly 560 -----------WEG---------LVPTTLPPTP 572 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoU | NP_001036266.1 | Wrch_1 | 393..562 | CDD:133330 | 73/206 (35%) |
RHO | 395..559 | CDD:197554 | 68/189 (36%) | ||
rhobtb4 | NP_001352487.1 | RhoBTB | 26..220 | CDD:133275 | 72/195 (37%) |
BTB | <426..486 | CDD:333434 | |||
BTB | 505..612 | CDD:306997 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |