Sequence 1: | NP_001036266.1 | Gene: | RhoU / 31945 | FlyBaseID: | FBgn0083940 | Length: | 582 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001037861.1 | Gene: | rnd1b / 553414 | ZFINID: | ZDB-GENE-060315-7 | Length: | 232 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 65/203 - (32%) |
---|---|---|---|
Similarity: | 103/203 - (50%) | Gaps: | 11/203 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 390 QPSI---KCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQD 451
Fly 452 TLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVLN 514
Fly 515 KLQTNGEEAISYADAWDLATTIGAK-YIETSSATQDK-VKDVFDTAIW---EGLVPTTLP-PTPS 573
Fly 574 FWRKLFCL 581 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoU | NP_001036266.1 | Wrch_1 | 393..562 | CDD:133330 | 56/178 (31%) |
RHO | 395..559 | CDD:197554 | 54/167 (32%) | ||
rnd1b | NP_001037861.1 | Rnd1_Rho6 | 1..232 | CDD:206737 | 65/203 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |