DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rhoub

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001017784.2 Gene:rhoub / 550481 ZFINID:ZDB-GENE-050417-308 Length:237 Species:Danio rerio


Alignment Length:289 Identity:104/289 - (35%)
Similarity:135/289 - (46%) Gaps:73/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 DYGSNPLPPTPPQLKQQSVISRSPLQQSLSDTSAASSGKGSKFLLRKRKSKKTTAAAAATTEAAT 376
            ||.:...||.||.:.|             |.::|...|:                          
Zfish     2 DYSNLMAPPVPPHMPQ-------------SPSAAHCQGR-------------------------- 27

  Fly   377 TAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVH 441
                           .:|||.:||||||||:||:||..|.:..:::|||.|.::|.|.|:..||.
Zfish    28 ---------------LLKCVFLGDGAVGKTSLIVSYTTNGYPTKYVPTAFDDFSAVVQVDGQPVR 77

  Fly   442 LTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQA 504
            |.:|||||||..|.||..||..:||.|||||||.|.:|:.|..||.|:..:  ....:||||||.
Zfish    78 LQLCDTAGQDEFDKLRHFCYTRTDVLLLCFSVVSPASFQNIGEKWVPEIRRRCPLTPVILVGTQC 142

  Fly   505 DLRTSPNVLNKLQTNGEEAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEGL----- 563
            |||....||..|....|..:...||..||..||| .|||.||.||..:|:|||.||..||     
Zfish   143 DLRQDVKVLIDLARRRERPVLEEDARALADKIGAVSYIECSSLTQKNLKEVFDAAISVGLRHSDR 207

  Fly   564 -------VPTTLPP----TPSFWRKLFCL 581
                   |.:|...    :.|:|:|..|:
Zfish   208 RARRERKVHSTADKMKMLSKSWWKKYICI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 86/171 (50%)
RHO 395..559 CDD:197554 83/166 (50%)
rhoubNP_001017784.2 Wrch_1 29..198 CDD:133330 84/168 (50%)
RHO 31..202 CDD:197554 85/170 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.