DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rhoua

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001007444.1 Gene:rhoua / 492802 ZFINID:ZDB-GENE-040618-3 Length:254 Species:Danio rerio


Alignment Length:308 Identity:106/308 - (34%)
Similarity:148/308 - (48%) Gaps:80/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 GGGPFIFGIAPEQQVTDYGSNP---LPPTPPQLKQQSVISRSPLQQSLSDTSAASSGKGSKFLLR 357
            |||             :|...|   :||.||                                  
Zfish     6 GGG-------------EYKPVPGTVVPPVPP---------------------------------- 23

  Fly   358 KRKSKKTTAAAAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHI 422
             |:.:....::|..:...|.|::           .:|||||||||||||:||:||..|.:..|::
Zfish    24 -RRLRSRDLSSAVKSRFGTAAER-----------RVKCVLVGDGAVGKTSLIVSYTTNGYPTEYV 76

  Fly   423 PTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWA 487
            |||.|.:.|.|.|:..||.|.:|||||||..|.||.|||.::||||||||||.|.:|:.::.||.
Zfish    77 PTAFDNFAAVVAVDGKPVKLQLCDTAGQDEFDKLRPLCYTNADVFLLCFSVVSPSSFQNVREKWV 141

  Fly   488 PKFAK--TKAALILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTIGA-KYIETSSATQD 549
            |:..:  .:|.::|||||:|||....||.:|....|..:...||...|..:.| .|:|.|:.||.
Zfish   142 PEIRRHCPRAPILLVGTQSDLREDVKVLIQLAQYKERPVEPQDASVCAEEVQAVSYMECSALTQK 206

  Fly   550 KVKDVFDTAIWEGL--------------VPTTLPP-TPSFWRKLFCLA 582
            .:|:||||||...:              .|..:.. :.|:|:|..|||
Zfish   207 NLKEVFDTAIVASIQYSDSQQQKRLKKRTPDKMRKLSESWWKKYCCLA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 86/171 (50%)
RHO 395..559 CDD:197554 83/166 (50%)
rhouaNP_001007444.1 Wrch_1 47..219 CDD:133330 86/171 (50%)
RHO 49..221 CDD:197554 85/171 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.