DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and RND3

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001241667.1 Gene:RND3 / 390 HGNCID:671 Length:244 Species:Homo sapiens


Alignment Length:189 Identity:64/189 - (33%)
Similarity:108/189 - (57%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 AKKDGKKAIAQPQPSIKC--VLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPV 440
            ::|...|:|..|..::||  |:|||...|||.|:..:.::.|...::||..:.|.|...::...:
Human     7 SQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRI 71

  Fly   441 HLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK----TKAALILVG 501
            .|::.||:|....|.:|.|.|||||..|:||.:.:|||..::..||..:..:    ||  ::|||
Human    72 ELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTK--MLLVG 134

  Fly   502 TQADLRTSPNVLNKLQTNGEEAISYADAWDLATTIG-AKYIETSS-ATQDKVKDVFDTA 558
            .::||||..:.|.:|..:.:..:||....::|..|| |.|||.|: .:::.|:|:|..|
Human   135 CKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 60/174 (34%)
RHO 395..559 CDD:197554 59/172 (34%)
RND3NP_001241667.1 Rnd3_RhoE_Rho8 19..200 CDD:206735 60/177 (34%)
Effector region. /evidence=ECO:0000255 52..60 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.