DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rnd2

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001010953.1 Gene:Rnd2 / 303553 RGDID:1306172 Length:228 Species:Rattus norvegicus


Alignment Length:169 Identity:55/169 - (32%)
Similarity:92/169 - (54%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 KCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRE 458
            |.|:|||...|||.|:..:.::.:...::||..:.|.|...:::..:.|.:.||:|....|.:|.
  Rat     9 KIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRP 73

  Fly   459 LCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVLNKLQTNGE 521
            |.|||||..|:||.:.:|||..::..||..:..:  ..|.::|||.:.|:||....|.:|.....
  Rat    74 LAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRL 138

  Fly   522 EAISYADAWDLATTIGA-KYIETSSATQDK-VKDVFDTA 558
            ..:::.....||..:|| .|:|.||.:.:: |:|||..|
  Rat   139 IPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 55/169 (33%)
RHO 395..559 CDD:197554 54/168 (32%)
Rnd2NP_001010953.1 P-loop_NTPase 7..228 CDD:304359 55/169 (33%)
RHO 10..182 CDD:197554 54/168 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.