DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rhod

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001099793.1 Gene:Rhod / 293660 RGDID:1310985 Length:210 Species:Rattus norvegicus


Alignment Length:211 Identity:78/211 - (36%)
Similarity:117/211 - (55%) Gaps:13/211 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 AKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHL 442
            ::.:|::|....:| ||.||||||..|||:|::.:....|...:.||..:.|||.:.:...||.|
  Rat     4 SQTEGEEAPHSGRP-IKVVLVGDGGCGKTSLMMVFANGAFPESYNPTVFERYNATLQMKGKPVRL 67

  Fly   443 TICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPK---FAKTKAALILVGTQA 504
            .|.||||||..|.||.|.|||::|.||||.|..|.:|..:..:|.|:   |.| ...:|:||.:.
  Rat    68 QIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCK-GVPIIVVGCKI 131

  Fly   505 DLRTSPNVLNKLQTNGEEAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEGLVPTTL 568
            |||....::|.|:....|.::|....|:|.::|| .|:|.|:...|.|:.||..|....|...  
  Rat   132 DLRKDKVLVNTLRKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVALSSR-- 194

  Fly   569 PPTPSFWRKL---FCL 581
              :.:|||::   ||:
  Rat   195 --SHNFWRRITQNFCV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 69/172 (40%)
RHO 395..559 CDD:197554 66/167 (40%)
RhodNP_001099793.1 Rho4_like 16..210 CDD:206704 76/199 (38%)
RHO 20..192 CDD:197554 67/172 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.