Sequence 1: | NP_001036266.1 | Gene: | RhoU / 31945 | FlyBaseID: | FBgn0083940 | Length: | 582 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055285.1 | Gene: | RND1 / 27289 | HGNCID: | 18314 | Length: | 232 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 69/204 - (33%) |
---|---|---|---|
Similarity: | 105/204 - (51%) | Gaps: | 11/204 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 389 PQPSI---KCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQ 450
Fly 451 DTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVL 513
Fly 514 NKLQTNGEEAISYADAWDLATTIGAK-YIETSSATQDK-VKDVFDTAIWEGL-VPTTLP---PTP 572
Fly 573 SFWRKLFCL 581 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoU | NP_001036266.1 | Wrch_1 | 393..562 | CDD:133330 | 58/175 (33%) |
RHO | 395..559 | CDD:197554 | 56/167 (34%) | ||
RND1 | NP_055285.1 | Rnd1_Rho6 | 1..232 | CDD:206737 | 69/204 (34%) |
Effector region. /evidence=ECO:0000255 | 42..50 | 2/7 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |