Sequence 1: | NP_001036266.1 | Gene: | RhoU / 31945 | FlyBaseID: | FBgn0083940 | Length: | 582 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780301.1 | Gene: | Rhof / 23912 | MGIID: | 1345629 | Length: | 211 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 65/195 - (33%) |
---|---|---|---|
Similarity: | 102/195 - (52%) | Gaps: | 16/195 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 368 AAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEH-IPTASDIYNA 431
Fly 432 DVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAKTKAA 496
Fly 497 L--ILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTI-GAKYIETSSATQDKVKDVFDTA 558
Fly 559 558 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoU | NP_001036266.1 | Wrch_1 | 393..562 | CDD:133330 | 60/170 (35%) |
RHO | 395..559 | CDD:197554 | 59/168 (35%) | ||
Rhof | NP_780301.1 | Rho4_like | 17..211 | CDD:206704 | 61/184 (33%) |
Effector region. /evidence=ECO:0000255 | 48..56 | 1/7 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1091615at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |