DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rhov

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_011237767.1 Gene:Rhov / 228543 MGIID:2444227 Length:281 Species:Mus musculus


Alignment Length:296 Identity:109/296 - (36%)
Similarity:148/296 - (50%) Gaps:51/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 SNPLPPTPPQLKQQSVISRSPLQQSLSDTSAASSGKGSKF------------LLRKRKSKKTTAA 367
            |.||...|                ||...||  ||.|:.|            ||.:.::......
Mouse     5 SQPLAGVP----------------SLDRLSA--SGCGTCFPECRGAWSGLAPLLPQERTMPPREL 51

  Fly   368 AAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNAD 432
            :.|.......:....::..|.|:..|||||||||||||::||:||..|.:...:.|||.|.::..
Mouse    52 SEAEPPPLPASTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQ 116

  Fly   433 VNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFA--KTKA 495
            |.|:.:||.:.:.|||||:..|.||.|||||:||||.|||||:|.:|:.|..||.|:..  ..:|
Mouse   117 VLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQA 181

  Fly   496 ALILVGTQADLRTSPNVLNKLQTNGEEA-ISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTA 558
            .::|||||||||...|||.:|...|.|. :....|..||..|.| .|:|.|:.||..:|:|||:|
Mouse   182 PVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSA 246

  Fly   559 IWEGL--------------VPTTLPPTPSFWRKLFC 580
            |...:              |.|.   :...|:|.||
Mouse   247 ILSAIEHKARLEKKLNAKGVRTL---SRCRWKKFFC 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 86/172 (50%)
RHO 395..559 CDD:197554 82/167 (49%)
RhovXP_011237767.1 Wrch_1 77..250 CDD:133330 86/172 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.