DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rnd2

DIOPT Version :10

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_033838.1 Gene:Rnd2 / 11858 MGIID:1338755 Length:227 Species:Mus musculus


Alignment Length:169 Identity:55/169 - (32%)
Similarity:92/169 - (54%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 KCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRE 458
            |.|:|||...|||.|:..:.::.:...::||..:.|.|...:::..:.|.:.||:|....|.:|.
Mouse     9 KIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRP 73

  Fly   459 LCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVLNKLQTNGE 521
            |.|||||..|:||.:.:|||..::..||..:..:  ..|.::|||.:.|:||....|.:|.....
Mouse    74 LAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRL 138

  Fly   522 EAISYADAWDLATTIGA-KYIETSSATQDK-VKDVFDTA 558
            ..:::.....||..:|| .|:|.||.:.:: |:|||..|
Mouse   139 IPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 55/169 (33%)
Rnd2NP_033838.1 Rnd2_Rho7 7..227 CDD:206736 55/169 (33%)
Effector region. /evidence=ECO:0000255 36..44 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..227
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.