DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and Rhoa

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001300890.1 Gene:Rhoa / 11848 MGIID:1096342 Length:193 Species:Mus musculus


Alignment Length:168 Identity:67/168 - (39%)
Similarity:100/168 - (59%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 KCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRE 458
            |.|:|||||.|||.|::.:.:::|...::||..:.|.||:.|:...|.|.:.|||||:..|.||.
Mouse     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71

  Fly   459 LCYPDSDVFLLCFSVVKPETFRAIKTKWAP--KFAKTKAALILVGTQADLRTSPNVLNKLQTNGE 521
            |.|||:||.|:|||:..|::...|..||.|  |.......:||||.:.|||...:...:|....:
Mouse    72 LSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQ 136

  Fly   522 EAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTA 558
            |.:...:..|:|..||| .|:|.|:.|:|.|::||:.|
Mouse   137 EPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 67/168 (40%)
RHO 395..559 CDD:197554 66/167 (40%)
RhoaNP_001300890.1 RhoA_like 5..179 CDD:206662 67/168 (40%)
Effector region. /evidence=ECO:0000255 34..42 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.