DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoU and rhov

DIOPT Version :9

Sequence 1:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001122131.1 Gene:rhov / 100038217 XenbaseID:XB-GENE-489435 Length:240 Species:Xenopus tropicalis


Alignment Length:202 Identity:87/202 - (43%)
Similarity:122/202 - (60%) Gaps:14/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 IKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLR 457
            ||||||||||||||:|::||..|.:..|:.|||.|.::..|.|:.:||.:.:||||||:..|.||
 Frog    37 IKCVLVGDGAVGKTSLVISYTINGYPTEYQPTALDTFSVQVLVDGAPVRIQLCDTAGQEDFDHLR 101

  Fly   458 ELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFA--KTKAALILVGTQADLRTSPNVLNKLQTNG 520
            .|||.::||||:|||||.|.:|:.:..||.|:..  .....::|||||||||...|||..|..:.
 Frog   102 SLCYAETDVFLVCFSVVNPSSFQNVTEKWIPEIRTHSPHTPIVLVGTQADLRDDVNVLINLSRSH 166

  Fly   521 EEAISYADAWDLATTIGAK-YIETSSATQDKVKDVFDTAIWEGL-----VPTTLPP------TPS 573
            .:.:|.:.|..:|..|.|: |||.|:.||..:|:|||.:|...:     :...|..      :..
 Frog   167 VKPVSESQAQAVAQKIRAQTYIECSALTQKNLKEVFDASILSAIKHKARLEKKLTSKGVKRLSKC 231

  Fly   574 FWRKLFC 580
            .|:|.||
 Frog   232 RWKKYFC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 82/171 (48%)
RHO 395..559 CDD:197554 79/166 (48%)
rhovNP_001122131.1 Wrch_1 37..209 CDD:133330 82/171 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.