DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Chl1

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:259 Identity:58/259 - (22%)
Similarity:94/259 - (36%) Gaps:71/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IMWVKE------HG-NNSTIVQTGRVLVLRNVSTTDAGIYVCFASVPRPSTTATSATT------S 104
            :.|.|:      :| .:..||..|..|.:.|:|..|.|||.|.|.....||:..:..|      .
  Rat   565 LSWSKDGEAFEMNGTEDGRIVIDGANLTISNISGEDQGIYSCSAQTALDSTSGKTQVTVLGVPDP 629

  Fly   105 PQN--LQDKETRPL-------EDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLIVRTVPG 160
            |:|  |.:::.|.:       :|.:....|.:...:...:|....||:..:..:.|.:::...|.
  Rat   630 PRNLLLSERQNRSVRLSWEAGDDHNSKISEYIVEFEGNREEPGKWEELTRVRGEETDVVLPLAPY 694

  Fly   161 PVSQLYFKASTILGFLIWRFNKTQSGGY------------------------------PVRSFT- 194
            ...|....|...:|    :.:.:|...:                              |::|.. 
  Rat   695 VRYQFRVTAVNEVG----KSHSSQPSDHHETPPAAPDKNPHNIRVQASQPKEMIIKWEPLKSMEQ 755

  Fly   195 ----AEYRNVSYKTPPANASFEHAWSRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNELGSG 254
                .||| ||:|  |..|..|  |......|....|....||  ||   |:.::.|.|:||||
  Rat   756 NGPGLEYR-VSWK--PQGAPEE--WEEETVTNHTLRVMTPTVY--AP---YDVQVQAINQLGSG 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 14/43 (33%)
Ig strand B 43..47 CDD:409358
Ig strand C 52..56 CDD:409358 0/2 (0%)
Ig strand F 84..89 CDD:409358 3/4 (75%)
Chl1XP_038964701.1 Ig 34..125 CDD:472250
Ig strand B 52..56 CDD:409353
Ig strand C 65..69 CDD:409353
Ig strand E 89..93 CDD:409353
Ig strand F 105..110 CDD:409353
Ig strand G 119..122 CDD:409353
IgI_2_L1-CAM_like 134..224 CDD:409432
Ig strand A 134..137 CDD:409432
Ig strand A' 139..143 CDD:409432
Ig strand B 146..154 CDD:409432
Ig strand C 161..167 CDD:409432
Ig strand C' 170..173 CDD:409432
Ig strand D 179..183 CDD:409432
Ig strand E 185..189 CDD:409432
Ig strand F 200..208 CDD:409432
Ig strand G 211..224 CDD:409432
Ig 261..343 CDD:472250
Ig strand B 273..277 CDD:409353
Ig strand C 286..290 CDD:409353
Ig strand E 308..312 CDD:409353
Ig strand F 322..327 CDD:409353
Ig strand G 335..338 CDD:409353
Ig4_L1-NrCAM_like 347..434 CDD:409367
Ig strand B 363..367 CDD:409367
Ig strand C 376..380 CDD:409367
Ig strand E 399..403 CDD:409367
Ig strand F 413..418 CDD:409367
Ig strand G 426..429 CDD:409367
Ig 447..524 CDD:472250
Ig strand B 456..460 CDD:409353
Ig strand C 469..473 CDD:409353
Ig strand E 492..496 CDD:409353
Ig strand F 506..511 CDD:409353
Ig strand G 519..522 CDD:409353
Ig 528..627 CDD:472250 18/61 (30%)
Ig strand B 547..551 CDD:409353
Ig strand C 564..568 CDD:409353 0/2 (0%)
Ig strand E 589..593 CDD:409353 1/3 (33%)
Ig strand F 603..608 CDD:409353 3/4 (75%)
Ig strand G 616..619 CDD:409353 0/2 (0%)
FN3 <626..>867 CDD:442628 40/198 (20%)
FN3 627..716 CDD:238020 15/92 (16%)
FN3 832..926 CDD:238020
FN3 931..1026 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.