DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and DIP-delta

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:262 Identity:50/262 - (19%)
Similarity:86/262 - (32%) Gaps:84/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ATDKGGNVSIPCIAQG----NIMWVKEHGNNSTIVQTGRVLV-------LRNVSTTDAGIYVCFA 89
            |..:..|:::.|.|.|    .|:|.:|.|....:.:..:|||       |..||..:.|.|:|.|
  Fly   158 AVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIA 222

  Fly    90 SVPRPSTTATSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLI 154
                  |.....:.|.:.:.|.|..|:           ....:||..|....:|....|      
  Fly   223 ------TNGVPPSVSKRIILDVEFSPM-----------IWVPNQLVGAPSGTDVTIDCH------ 264

  Fly   155 VRTVPGPVSQLYFKASTILGFLIWRFNKTQSGGYPVRSFTAEYRNVSYKTPPANASFEHAWSRMD 219
              |...|.:.:|           |.:|....  .|.:.:..:|...||:.               
  Fly   265 --TEAHPKAIIY-----------WVYNSVMV--LPSKKYKTDYTENSYRA--------------- 299

  Fly   220 PINIAFNVRQMEVYRLAPNTTYEFRIWANNELGSGE------------VVTTNVT-TLPETKEED 271
              ::...:|.::.....     .:|..:.|.||..|            ..:..|| |..|::|.:
  Fly   300 --HMKLTIRNLQYGDFG-----NYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENN 357

  Fly   272 LI 273
            :|
  Fly   358 II 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 17/61 (28%)
Ig strand B 43..47 CDD:409358 0/3 (0%)
Ig strand C 52..56 CDD:409358 1/3 (33%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353
Ig strand E 105..112 CDD:409353
Ig strand F 122..127 CDD:409353
Ig strand G 134..137 CDD:409353
Ig 145..238 CDD:472250 21/85 (25%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 0/3 (0%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 1/2 (50%)
Ig 242..333 CDD:472250 21/144 (15%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/14 (7%)
Ig strand E 295..305 CDD:409353 2/26 (8%)
Ig strand F 315..320 CDD:409353 1/4 (25%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.