DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and NCAM2

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:340 Identity:72/340 - (21%)
Similarity:108/340 - (31%) Gaps:137/340 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FTQVLTVLSSTIKYNEYATDKGGNVSIPCIAQG----NIMWVK---------------------- 57
            |.||. |....|:.....|.:.|.|::.|.|:|    .|.|.:                      
Human   320 FLQVF-VQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKG 383

  Fly    58 EHGNNSTIVQTGRVLVLRNVSTTDAGIYVCFAS----------------VPRPSTTAT---SATT 103
            :||::|        |.:::|..:|:|.|.|.|:                .|:..:..|   |...
Human   384 QHGSSS--------LHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEG 440

  Fly   104 SPQNL---------------QDK----------------------ETRPLEDEDDGQGESVSPKD 131
            :|.|:               :||                      |..|..|.|.|:....:...
Human   441 NPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNH 505

  Fly   132 DQLKEAEMEEEVEYLAHQRTKLIVRTVPG--------PVSQLYFKASTILGFLIWRFNKTQS-GG 187
            ...:..      ||:      |.:..||.        .:||...|.|         |||..| ||
Human   506 IGTRFQ------EYI------LALADVPSSPYGVKIIELSQTTAKVS---------FNKPDSHGG 549

  Fly   188 YPVRSFTAEYRNVSYKTPPANASFEHAWSRMDPINIAFNVRQMEVY-RLAPNTTYEFRIWANNEL 251
            .|:..:..:.:.|:          ...|.    |..:..|:.|.|. .|.||||||.|:.|.|..
Human   550 VPIHHYQVDVKEVA----------SEIWK----IVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGK 600

  Fly   252 GSGEVVTTNV-TTLP 265
            |.|:.....: .|||
Human   601 GQGDYSKIEIFQTLP 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 16/76 (21%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/3 (33%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452
Ig strand A 46..51 CDD:409452
Ig strand A' 54..58 CDD:409452
Ig strand B 60..70 CDD:409452
Ig strand C 74..80 CDD:409452
Ig strand C' 83..85 CDD:409452
Ig strand D 91..97 CDD:409452
Ig strand E 99..107 CDD:409452
Ig strand F 114..121 CDD:409452
Ig strand G 126..137 CDD:409452
Ig 142..218 CDD:472250
Ig strand C 170..174 CDD:409353
Ig strand E 193..197 CDD:409353
IgI_1_MuSK 234..323 CDD:409562 1/2 (50%)
Ig strand A 234..237 CDD:409562
Ig strand A' 242..247 CDD:409562
Ig strand B 253..260 CDD:409562
Ig strand C 266..271 CDD:409562
Ig strand C' 273..275 CDD:409562
Ig strand D 282..285 CDD:409562
Ig strand E 289..295 CDD:409562
Ig strand F 302..309 CDD:409562
Ig strand G 315..323 CDD:409562 1/2 (50%)
IgI_NCAM-2 325..422 CDD:143278 20/104 (19%)
Ig strand A 325..330 CDD:143278 1/4 (25%)
Ig strand A' 334..338 CDD:143278 0/3 (0%)
Ig strand B 342..350 CDD:143278 2/7 (29%)
Ig strand C 356..362 CDD:143278 2/5 (40%)
Ig strand C' 365..368 CDD:143278 0/2 (0%)
Ig strand D 378..384 CDD:143278 0/5 (0%)
Ig strand E 387..393 CDD:143278 2/13 (15%)
Ig strand F 401..409 CDD:143278 4/7 (57%)
Ig strand G 412..422 CDD:143278 0/9 (0%)
Ig_3 426..504 CDD:464046 12/77 (16%)
FN3 521..613 CDD:238020 30/114 (26%)
fn3 619..703 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.