DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and NCAM1

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:562 Identity:92/562 - (16%)
Similarity:148/562 - (26%) Gaps:283/562 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NEYATDKGGNVSIPCIAQG----NIMW-----------------------------VKEHGNNST 64
            |:.|.:....|::.|.|.|    :|.|                             |:.|...|:
Human   315 NQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSS 379

  Fly    65 IVQTGRVLVLRNVSTTDAGIYVCFAS----------------VPR-------------------- 93
                   |.|:::..||||.|:|.||                .|:                    
Human   380 -------LTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCE 437

  Fly    94 ----PSTTAT---------SATTSPQNLQDK------ETRPLEDEDDGQ----------GESV-- 127
                ||.|.:         |:..|...:.:.      |..|..:.|.|.          .||:  
Human   438 VFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEF 502

  Fly   128 ---------SPKDDQLKEAEMEEEVEYLAHQRTKLIVRTVPGPVSQLYFKASTILGFLIWRFNKT 183
                     ||..||::......:|::...:.|                                
Human   503 ILVQADTPSSPSIDQVEPYSSTAQVQFDEPEAT-------------------------------- 535

  Fly   184 QSGGYPVRSFTAEYRNVSYKTPPANASFEHAW---------SRMDPINIAFNVRQMEVYRLAPNT 239
              ||.|:..:.||:|.|.          |..|         :.|:.|        :.:..|.|.|
Human   536 --GGVPILKYKAEWRAVG----------EEVWHSKWYDAKEASMEGI--------VTIVGLKPET 580

  Fly   240 TYEFRIWANNELGSGEVVTTNVTTLPETKE-----------ED----LIRLIKPD---------- 279
            ||..|:.|.|..|.||:...:.......:|           ||    .:.|||.|          
Human   581 TYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYL 645

  Fly   280 ---------------------------LD-NFDPRIWIVA------------------------- 291
                                       || |.:..:::||                         
Human   646 VRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPA 710

  Fly   292 ---------VSIVLGTLVILAIGLCIVLSKECYQSAQMELQDGWDSIELIPNIILNPGFSESDGG 347
                     ...::|.|:::.:.|.:|:...||         ..:...|...|.:|     ..|.
Human   711 NGSPTSGLSTGAIVGILIVIFVLLLVVVDITCY---------FLNKCGLFMCIAVN-----LCGK 761

  Fly   348 PEPGGQGHGGSAGDQDAGEDDDDDVAMPFPRTIIFGQHHRTP 389
            ..||.:|.....|.....:|:..:     |...:..:..|||
Human   762 AGPGAKGKDMEEGKAAFSKDESKE-----PIVEVRTEEERTP 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 17/83 (20%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 2/32 (6%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353
Ig 211..307 CDD:472250
Ig strand B 231..235 CDD:409353
Ig strand C 244..248 CDD:409353
Ig strand E 270..274 CDD:409353
Ig strand F 284..289 CDD:409353
Ig strand G 297..300 CDD:409353
IgI_NCAM-1 306..412 CDD:143277 21/103 (20%)
Ig strand A 306..311 CDD:143277
Ig strand A' 315..319 CDD:143277 1/3 (33%)
Ig strand B 324..332 CDD:143277 2/7 (29%)
Ig strand C 338..344 CDD:143277 2/5 (40%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 1/5 (20%)
Ig strand E 377..383 CDD:143277 2/12 (17%)
Ig strand F 391..399 CDD:143277 4/7 (57%)
Ig strand G 402..412 CDD:143277 0/9 (0%)
IG_like 421..499 CDD:214653 9/77 (12%)
Ig strand B 432..436 CDD:409353 0/3 (0%)
Ig strand C 445..449 CDD:409353 1/3 (33%)
Ig strand E 472..476 CDD:409353 0/3 (0%)
Ig strand F 486..491 CDD:409353 0/4 (0%)
fn3 511..598 CDD:394996 28/138 (20%)
fn3 612..693 CDD:394996 11/80 (14%)
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.