DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Lac

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:137 Identity:36/137 - (26%)
Similarity:54/137 - (39%) Gaps:34/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVLTLSSFNLLFFTQVLTVLSSTIKY--NEYATDKGGNVSIPCIAQ----GNIMWVKEHGNNSTI 65
            |.|.|:    :|..|.|...:.||.|  .|...|.||.|...|..|    .|::::|. .::...
  Fly    12 STLLLA----IFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKT-DSDPVF 71

  Fly    66 VQTGRVLVLR----------NVST----------TDAGIYVC---FASVPRPSTTATSATTSPQN 107
            :.||..||::          |.||          ||||.|.|   .::|.:.|.....:...|..
  Fly    72 LSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPV 136

  Fly   108 LQDKETR 114
            :.|..|:
  Fly   137 ISDNSTQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 20/77 (26%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/3 (33%)
Ig strand F 84..89 CDD:409358 2/7 (29%)
LacNP_523713.2 IG_like 36..131 CDD:214653 24/95 (25%)
Ig strand B 46..50 CDD:409381 1/3 (33%)
Ig strand C 60..63 CDD:409381 0/2 (0%)
Ig strand E 96..100 CDD:409381 0/3 (0%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 3/10 (30%)
Ig 227..318 CDD:472250
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.