DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and fipi

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:305 Identity:62/305 - (20%)
Similarity:97/305 - (31%) Gaps:109/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSSSVLTLSSFNLLFFTQVLTVLSSTIKYNEYATDKGGNVSIPCIAQG----NIMWVKEHGNNS 63
            |..|....|..:..:.||:..||:  |:|..|.||       |.|..:|    |:.|   |.|..
  Fly   105 SLHSKSFDLIVYQKITFTENATVM--TVKEGEKAT-------ILCEVKGEPQPNVTW---HFNGQ 157

  Fly    64 TIVQTGRV-----------LVLRNVSTTDAGIYVCFASVPRPSTTATSATTSPQNLQDKETRPLE 117
            .| ..|..           |::..|:..|.|.|.|.|.                           
  Fly   158 PI-SAGAADDSKFRILADGLLINKVTQNDTGEYACRAY--------------------------- 194

  Fly   118 DEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLIVRTVPGPVSQLYFKASTILGFLIWRFNK 182
                 |..|::        ::|:|              |||   :.::..|.       ||....
  Fly   195 -----QVNSIA--------SDMQE--------------RTV---LMKIEHKP-------IWSKTP 222

  Fly   183 TQSGGYPVRSFTAEYRNVSYKTPPANASFEHAWSRMDPINIAFNVR------QMEVYRLAPNTTY 241
            ..|..|...:.||.....:...||||.::....:::...|..:.::      .:.::.|..:...
  Fly   223 FVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFD 287

  Fly   242 EFRIWANNELGSGEVVTTNVTTLPETKEEDLIRLIKPDLDNFDPR 286
            .:|..|.|:||     |...||..|..|:      .|...||..|
  Fly   288 NYRCRARNDLG-----TIERTTRLEQGEK------PPSPANFQLR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 15/65 (23%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/3 (33%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 3/9 (33%)
IgI_Twitchin_like 120..208 CDD:409541 30/154 (19%)
Ig strand A 120..123 CDD:409541 1/2 (50%)
Ig strand A' 127..131 CDD:409541 2/5 (40%)
Ig strand B 134..141 CDD:409541 4/13 (31%)
Ig strand C 149..154 CDD:409541 2/7 (29%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 4/39 (10%)
Ig strand G 198..208 CDD:409541 4/31 (13%)
IG_like 228..307 CDD:214653 17/83 (20%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 1/4 (25%)
FN3 312..415 CDD:238020 4/10 (40%)

Return to query results.
Submit another query.