DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and CG33543

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:325 Identity:66/325 - (20%)
Similarity:111/325 - (34%) Gaps:96/325 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSSFNLLFFTQVLTVLSSTIKYNE----YATDKGGNVSIPCIAQG----NIMWV--KEHGNNSTI 65
            |:||.||        ::..|.:.:    .:..:|.:..:.|..:|    .:.|:  .|:.|....
  Fly   141 LASFELL--------VNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNS 197

  Fly    66 VQTGRV---LVLRNVSTTDAGIYVCFASVPRPSTTATSATTSPQNLQDK------ETRPLED--- 118
            .:..|:   |.:||||..|||.|.|.|....|:.:.:...|....:|.|      ||.|::.   
  Fly   198 TKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYV 262

  Fly   119 ------EDDGQGESVSPKDD--------------------------QLKEAEMEEEVEYLAHQRT 151
                  ..|..||   |...                          ||:.....:..:|......
  Fly   263 GGAVNLSCDAMGE---PPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKVAN 324

  Fly   152 KL-----IVRTVPGPVSQLYFKASTILGFLIWRFNKTQSGGYPVRSFTAEYRNVS-------YKT 204
            .|     :::..|||..         ||...::..|..:.|:.:...|....|||       |:.
  Fly   325 PLGMLERVIKLRPGPKP---------LGPRRFQLKKLYTNGFELDIQTPRMSNVSDEMQIYGYRV 380

  Fly   205 P-PANASFEHA---WSRMDPINIAFN-VRQMEVYRLAPNTTYEFRIWANNELGSGE-----VVTT 259
            . .::..|:.:   ||.....:.:|: .:...:..|..||||..|..:.|..|..:     |.||
  Fly   381 AYMSDTEFKFSAGNWSYAKQRDFSFHGGKHFIIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTT 445

  Fly   260  259
              Fly   446  445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 17/59 (29%)
Ig strand B 43..47 CDD:409358 0/3 (0%)
Ig strand C 52..56 CDD:409358 0/3 (0%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
CG33543NP_001014458.3 Ig <71..>123 CDD:472250
Ig strand E 105..109 CDD:409353
Ig strand F 119..123 CDD:409353
Ig 153..239 CDD:472250 19/85 (22%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 9/82 (11%)
Ig strand B 266..270 CDD:409353 0/3 (0%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 1/4 (25%)
FN3 341..445 CDD:238020 22/112 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.