DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and DIP-kappa

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:399 Identity:68/399 - (17%)
Similarity:120/399 - (30%) Gaps:148/399 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FTQVLT--VLSSTIKYNEYATDKGGNVSIPCIAQG----NIMWVKEHGNNSTI------VQTGRV 71
            :.||:.  ::...:..|:....:|.|:|:.|.|:|    .:||.:|.|....|      |..|.:
  Fly   169 YLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGEL 233

  Fly    72 LVLRNVSTTDAGIYVCFASVPRPSTTATSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKE 136
            |.:..||......|:|.||                              :|...|:|.:      
  Fly   234 LHITKVSRLHMAAYLCVAS------------------------------NGVPPSISKR------ 262

  Fly   137 AEMEEEVEYLAHQRTKL-IVRTVPGPVSQLYFKASTILGFLIWRFNKTQSGGYP--VRSFTAEYR 198
                      .|.|.:. .:.::|..:...|.....||        :..:..||  :..:|.|..
  Fly   263 ----------VHLRVQFPPMLSIPNQLEGAYLGQDVIL--------ECHTEAYPASINYWTTERG 309

  Fly   199 N-VSYKTPPANASFEHAWSRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNELG--SGEVVTTN 260
            : :...|..|...:|    ....::......::::..:.||....:|..|.|.||  .|.:....
  Fly   310 DMIISDTSRAGDKYE----TTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDE 370

  Fly   261 VTTLPETKEEDLIRLIKPDLDNFDPRIWIVAVSIVLGTLVILAIGLCIVLSKECYQSAQMELQDG 325
            :.| |.|.....:.|:....|                                    .:...::.
  Fly   371 MPT-PTTAIISEMSLLNRSYD------------------------------------GKRRHRNK 398

  Fly   326 WDSIELIPNIILNPGFSESDGGPEPGGQG-HGGSAGDQDAGEDDDDDVAMPFPRTIIFGQHHRTP 389
            :||...:|           |.|.|....| .|.:||:.                    |.:::||
  Fly   399 FDSANALP-----------DYGVEEWRDGAQGNNAGNN--------------------GDNNQTP 432

  Fly   390 ---PPPRLH 395
               ||...|
  Fly   433 VRNPPGAFH 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 18/60 (30%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/3 (33%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 2/4 (50%)
Ig strand B 91..95 CDD:409353
Ig strand C 104..108 CDD:409353
Ig strand E 139..143 CDD:409353
Ig strand F 153..158 CDD:409353
Ig strand G 165..168 CDD:409353
Ig 176..267 CDD:472250 25/136 (18%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/18 (6%)
IG_like 282..368 CDD:214653 18/97 (19%)
Ig strand B 288..292 CDD:409353 2/11 (18%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 0/9 (0%)
Ig strand F 350..355 CDD:409353 1/4 (25%)
Ig strand G 363..366 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.