DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Nrg

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:285 Identity:69/285 - (24%)
Similarity:109/285 - (38%) Gaps:69/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ATDKGGNVSIPCIAQGN----IMWVKEHG---NNSTIVQTGRVLVLRNVSTTDAGIYVCFASVPR 93
            :|..|.||:|.|...|:    :.|::...   .....||....|.:::|:.:|||.|.|:|....
  Fly   442 STVDGRNVTIKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKF 506

  Fly    94 PSTTA---------TSATTSPQNL-----QDKETRPLEDEDD------------------GQGES 126
            ....|         |..|..|||.     |....|..|..||                  .|...
  Fly   507 GEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFEAQPRF 571

  Fly   127 VSPKDDQLKEAE-ME-EEVEYLAHQRTK---------LIVRTVPGPVSQLYFKASTILGFLIWRF 180
            |...|:.|..|: || :..||....||:         |||:.||................:.|. 
  Fly   572 VKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQADKAEIHWE- 635

  Fly   181 NKTQSGG--YPVRSFTAEYRNVSYKTPPANASFEHAWSRMDPINIAFNVRQMEVYRLAPNTTYEF 243
               |.|.  .|:..:|.:: |.|: ||   ||::.|:.::...:.:|      |.:::|...|.|
  Fly   636 ---QQGDNRSPILHYTIQF-NTSF-TP---ASWDAAYEKVPNTDSSF------VVQMSPWANYTF 686

  Fly   244 RIWANNELGSG--EVVTTNVTTLPE 266
            |:.|.|::|:.  ...:.:.||.|:
  Fly   687 RVIAFNKIGASPPSAHSDSCTTQPD 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 16/57 (28%)
Ig strand B 43..47 CDD:409358 2/3 (67%)
Ig strand C 52..56 CDD:409358 0/7 (0%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
NrgNP_001245581.1 Ig 29..128 CDD:472250
Ig strand B 55..59 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 137..216 CDD:472250
Ig strand B 151..155 CDD:409353
Ig strand C 165..169 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 209..214 CDD:409353
ig 251..332 CDD:395002
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 314..319 CDD:409353
Ig strand G 328..331 CDD:409353
IgI_4_hemolin-like 339..427 CDD:409570
Ig strand A 339..342 CDD:409570
Ig strand A' 348..351 CDD:409570
Ig strand B 356..363 CDD:409570
Ig strand C 369..374 CDD:409570
Ig strand C' 377..379 CDD:409570
Ig strand D 387..391 CDD:409570
Ig strand E 393..397 CDD:409570
Ig strand F 406..414 CDD:409570
Ig strand G 417..427 CDD:409570
Ig 446..517 CDD:472250 18/70 (26%)
Ig strand B 449..453 CDD:409358 2/3 (67%)
Ig strand C 462..466 CDD:409358 0/3 (0%)
Ig strand E 483..487 CDD:409358 1/3 (33%)
Ig strand F 497..502 CDD:409358 2/4 (50%)
Ig strand G 510..513 CDD:409358 1/2 (50%)
Ig 521..615 CDD:472250 24/93 (26%)
Ig strand B 538..542 CDD:409353 0/3 (0%)
Ig strand C 553..557 CDD:409353 0/3 (0%)
Ig strand E 577..581 CDD:409353 1/3 (33%)
Ig strand F 591..596 CDD:409353 2/4 (50%)
Ig strand G 604..607 CDD:409353 0/2 (0%)
FN3 613..707 CDD:238020 23/108 (21%)
FN3 683..>1051 CDD:442628 9/29 (31%)
fn3 817..905 CDD:394996
fn3 918..1007 CDD:394996
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.