DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Igsf9b

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:253 Identity:59/253 - (23%)
Similarity:87/253 - (34%) Gaps:67/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EYATDKGGNVSIPCIAQGN----IMWVKEHGNNSTIVQTGRVLVLRNVSTTDAGIYVCFASVPRP 94
            ||..:.|..:.|||.|.|:    |.|.|                                 |.:|
  Rat   429 EYRQEAGRELLIPCAAAGDPFPVITWRK---------------------------------VGKP 460

  Fly    95 STTATSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLIVRTVP 159
            |.:..:|..| .:||   .|.|..||.|:.|.|:           ...|..:.......::.|.|
  Rat   461 SRSKHNALPS-GSLQ---FRALSKEDHGEWECVA-----------TNVVTSITASTHLTVIGTSP 510

  Fly   160 GPVSQLYFKASTILGFLIWRFNKTQSGGYPVRSFTAEYRNVSYKTPPANASF-EHAWSRMDPINI 223
            .....:....|.....:.|  .....|||. ::|:..|..:..:     |.| .|.|.   .:::
  Rat   511 HAPGSVRVHVSMTTANVSW--EPGYDGGYE-QTFSVWYGPLMKR-----AQFGPHDWL---SLSV 564

  Fly   224 AFNVRQMEVYRLAPNTTYEFRIWANNELGS---GEVVTTNVTTLPETKEEDLIRLIKP 278
            ......:.|..|.|.|.|:|.:.|.|.||:   .||||.|....|.|..|.|:.:..|
  Rat   565 PLGPSWLLVDSLEPETAYQFSVLAQNRLGTSAFSEVVTVNTLAFPVTTPEPLVLVTPP 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 9/54 (17%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/7 (14%)
Ig strand F 84..89 CDD:409358 0/4 (0%)
Igsf9bNP_001363879.1 Ig 41..115 CDD:409353
Ig strand B 41..45 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 96..100 CDD:409353
Ig strand F 110..115 CDD:409353
I-set 139..225 CDD:400151
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 191..195 CDD:409353
Ig strand F 205..210 CDD:409353
Ig strand G 218..221 CDD:409353
Ig_3 228..307 CDD:464046
Ig 336..410 CDD:472250
Ig strand B 342..346 CDD:409544
Ig strand C 355..360 CDD:409544
Ig strand E 380..384 CDD:409544
Ig strand F 394..399 CDD:409544
Ig strand G 407..410 CDD:409544
Ig 429..505 CDD:472250 26/123 (21%)
Ig strand B 438..442 CDD:409544 1/3 (33%)
Ig strand C 451..455 CDD:409544 1/3 (33%)
Ig strand E 471..475 CDD:409544 2/6 (33%)
Ig strand F 485..490 CDD:409544 1/4 (25%)
FN3 <490..>735 CDD:442628 34/155 (22%)
Ig strand G 498..501 CDD:409544 0/2 (0%)
FN3 510..605 CDD:238020 26/105 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.