DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and DIP-alpha

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:425 Identity:82/425 - (19%)
Similarity:127/425 - (29%) Gaps:171/425 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KGGNVSIPCIAQGN----IMWVKEHGNNSTIVQT-----------GRVLVLRNVSTTDAGIYVCF 88
            :|.:|.:.|.|:|.    :.|.:|.||...:...           |.||.|..:|..:.|.|:|.
  Fly   159 EGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCI 223

  Fly    89 ASVPRPSTTATSATTS---------PQNLQDKETRPLEDEDDGQGE---SVSPKDDQLKEAEMEE 141
            ||...|.:.:...:.|         |..|..   .||  ..|.|.|   ..|||           
  Fly   224 ASNGVPPSVSKRISLSIHFHPVIQVPNQLVG---APL--GTDVQIECHVEASPK----------- 272

  Fly   142 EVEYLAHQRTKLIVRT----VPGPVSQLYFKASTILGFLIWRFNKTQSGGYPVRSFTAEYRNVSY 202
            .:.|......::||.:    |......:|   .|.:..::.:|.|...|              ||
  Fly   273 SINYWIKDTGEMIVTSGKYHVQESSQSMY---ETKMSMIVRKFQKDDVG--------------SY 320

  Fly   203 KTPPANASFEHAWSRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNEL-------GSGEVVTTN 260
            :....|:..|          :..::|..|:  ..||..       .|.|       |:|..:..:
  Fly   321 RCIAKNSLGE----------VDSSIRLYEI--PGPNRN-------KNPLNGGGKGGGAGGSLDAD 366

  Fly   261 VTTLPETKEEDLIRLIKPDLDNFDPRIWIVAVSIVLGTLVILAIGLCIVLSKECYQSAQMELQDG 325
            ...:.:.|::                                        .|..||....|||.|
  Fly   367 ANDILKQKQQ----------------------------------------VKVTYQPEDEELQYG 391

  Fly   326 WDSIELIPNIILNPGFSESDGGPEPGGQGHGGSAGDQDAGEDDDDDVAMPFPRTIIFGQHHRTPP 390
              |:|..          |::|| |.||                    ..|....:.:...::   
  Fly   392 --SVEDF----------EAEGG-EGGG--------------------LTPLSPHVYYTSGNK--- 420

  Fly   391 PPRLHLP----PQHHRHQNQSHHHQYHHQQNQQQH 421
             |..|.|    ...|.||...|||.:::..|.|||
  Fly   421 -PATHKPGNSGGNQHLHQQHHHHHHHNNNNNNQQH 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 17/65 (26%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 0/7 (0%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653
Ig strand B 59..63 CDD:409353
Ig strand C 72..76 CDD:409353
Ig strand E 103..111 CDD:409353
Ig 152..240 CDD:472250 20/80 (25%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 2/3 (67%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 23/135 (17%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 1/3 (33%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.