DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Igsf9

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001100667.1 Gene:Igsf9 / 304982 RGDID:1304566 Length:1179 Species:Rattus norvegicus


Alignment Length:425 Identity:96/425 - (22%)
Similarity:133/425 - (31%) Gaps:177/425 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EYATDKGGNVSIPCIAQGN----IMWVK----------EHGNNSTIVQTGRVLVLRNVSTTDAGI 84
            ||..:.|.::.|||.|:|:    :.|.|          ...|||        |:||.::....|.
  Rat   427 EYFQEVGRDLLIPCSARGDPPPIVSWAKVGRGLQGQAQVDSNNS--------LILRPLTKEAHGR 483

  Fly    85 YVCFASVPRPSTTATSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQ 149
            :.|.|      ..|.:..|...|:....|.|                                |.
  Rat   484 WECSA------RNAVAHVTISTNVYVLGTSP--------------------------------HV 510

  Fly   150 RTKLIVRTVPGPVSQLYFKASTIL---GFLIWRFNKTQSGGYPVRSFTAEYRNVSYKTPPANASF 211
            .|.  |..||.|      |.:.:.   ||         .||| ::.|:..|..::.:...|:   
  Rat   511 VTN--VSVVPLP------KGANVSWEPGF---------DGGY-LQRFSVWYTPLAKRPDRAH--- 554

  Fly   212 EHAWSRMDPINIAFNVRQMEVYRLAPN----TTYEFRIWANNELGSG---EVV---------TTN 260
             |.|       ::..|.....:.|.|.    |.|:|.:.|.|:||||   |:|         |..
  Rat   555 -HDW-------VSLAVPMGATHLLVPGLQAYTQYQFSVLAQNKLGSGPFSEIVLSIPEGLPTTPA 611

  Fly   261 VTTLPETKEEDLIRLIKPDLDNFDPRIWIVAVSIVLGTLVILAIGLCIVLSKECYQSAQMELQDG 325
            |..||.|:       :.|.|   .|...:|||....|.|:                        .
  Rat   612 VPRLPPTE-------MPPPL---SPPRGLVAVRTPRGVLL------------------------H 642

  Fly   326 WDSIELIPNIILNPGFSESDGGPEPGGQG-HGGSAGDQD-AGEDDD-------DDVAMPFPRTII 381
            ||..||||..:        ||....|.|| .|....||. ||.:..       .||...| |.:.
  Rat   643 WDPPELIPERL--------DGYILEGRQGSQGWEILDQGVAGTEIQLLVPGLIKDVLYEF-RLVA 698

  Fly   382 FGQHHRTPP--------------PPRLHLP---PQ 399
            |...:.:.|              |.|..||   ||
  Rat   699 FADSYVSDPSNIANISTSGLEVYPSRTQLPGLLPQ 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 16/64 (25%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 0/7 (0%)
Ig strand F 84..89 CDD:409358 1/4 (25%)
Igsf9NP_001100667.1 IG_like 28..110 CDD:214653
Ig strand B 37..41 CDD:409353
Ig strand C 54..58 CDD:409353
Ig strand E 91..95 CDD:409353
IG_like 143..223 CDD:214653
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 189..193 CDD:409353
Ig strand F 203..208 CDD:409353
Ig strand G 216..219 CDD:409353
Ig_3 226..305 CDD:464046
Ig 322..407 CDD:472250
Ig strand B 333..344 CDD:409353
Ig strand C 353..358 CDD:409353
Ig strand E 378..382 CDD:409353
Ig strand F 392..397 CDD:409353
Ig 418..503 CDD:472250 22/89 (25%)
Ig strand B 436..440 CDD:409353 1/3 (33%)
Ig strand C 449..453 CDD:409353 0/3 (0%)
Ig strand E 469..473 CDD:409353 3/11 (27%)
Ig strand F 483..488 CDD:409353 1/4 (25%)
Ig strand G 496..499 CDD:409353 1/2 (50%)
FN3 508..599 CDD:238020 31/151 (21%)
FN3 625..715 CDD:238020 28/122 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 766..807
PHA03247 <777..1062 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..846
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 869..895
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..979
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.