DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Ncam2

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_981954.2 Gene:Ncam2 / 288280 RGDID:1303131 Length:837 Species:Rattus norvegicus


Alignment Length:334 Identity:67/334 - (20%)
Similarity:106/334 - (31%) Gaps:125/334 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FTQVLTVLSSTIKYNEYATDKGGNVSIPCIAQG----NIMWVK---------------------- 57
            |.||. |....::.....|.:.|:|::.|.|:|    .|.|.:                      
  Rat   295 FLQVF-VQPHILQLKNETTSENGHVTLICEAEGEPVPEITWKRAIDGVTFSEGDKSPDGRIEVKG 358

  Fly    58 EHGNNSTIVQTGRVLVLRNVSTTDAGIYVCFAS-------------------------------- 90
            :||.:|        |.:|:|..:|:|.|.|.|:                                
  Rat   359 QHGRSS--------LHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAPKFVSNQTMYYSWEG 415

  Fly    91 -------------------------VPRPSTTATSATTSPQNLQDKETRPLEDEDDGQGESVSPK 130
                                     :|..:||... |.|.......|..|..|.|.|:....:..
  Rat   416 NPINISCDVKANPPASIHWRREKLVLPAKNTTHLK-THSVGRKMILEIAPTSDNDFGRYNCTATN 479

  Fly   131 --DDQLKEAEMEEEVEYLAHQRTKLIVRTVPGPVSQLYFKASTILGFLIWRFNKTQS-GGYPVRS 192
              ..:.:|..:|......:.:..|:|      .:||...|.|         |||.:| ||.|:..
  Rat   480 RIGTRFQEYILELADVPSSPRGVKII------ELSQTTAKIS---------FNKPESHGGVPIHH 529

  Fly   193 FTAEYRNVSYKTPPANASFEHAWSRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNELGSGEVV 257
            :..:.:.|:.:|          |..:....:...|   .:..|.||||||.|:.|.|..|.|:..
  Rat   530 YQVDVKEVTSET----------WKIVRSHGVQTTV---VLSSLEPNTTYEVRVAAVNGKGQGDYS 581

  Fly   258 TTNV-TTLP 265
            ...: .|||
  Rat   582 KIEIFQTLP 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 17/76 (22%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/3 (33%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Ncam2NP_981954.2 IgI_1_NCAM-2 21..113 CDD:409452
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452
Ig strand G 101..112 CDD:409452
Ig 117..193 CDD:472250
Ig strand B 132..136 CDD:409353
Ig strand C 145..152 CDD:409353
Ig strand E 169..173 CDD:409353
Ig strand F 183..187 CDD:409353
Ig strand G 191..194 CDD:409353
IgI_1_MuSK 209..298 CDD:409562 1/2 (50%)
Ig strand A 209..212 CDD:409562
Ig strand A' 217..222 CDD:409562
Ig strand B 228..235 CDD:409562
Ig strand C 241..246 CDD:409562
Ig strand C' 248..250 CDD:409562
Ig strand D 257..260 CDD:409562
Ig strand E 264..270 CDD:409562
Ig strand F 277..284 CDD:409562
Ig strand G 290..298 CDD:409562 1/2 (50%)
Ig 300..397 CDD:472250 20/104 (19%)
Ig strand B 318..322 CDD:409353 1/3 (33%)
Ig strand C 331..335 CDD:409353 1/3 (33%)
Ig strand E 363..367 CDD:409353 2/11 (18%)
Ig strand F 377..382 CDD:409353 2/4 (50%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 10/78 (13%)
FN3 496..588 CDD:238020 29/119 (24%)
fn3 594..678 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.