DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Igsf9b

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:264 Identity:59/264 - (22%)
Similarity:84/264 - (31%) Gaps:89/264 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EYATDKGGNVSIPCIAQGN----IMWVKEHGNNSTIVQTGRVLVLRNVSTTDAGIYVCFASVPRP 94
            ||..:.|..:.|||.|.|:    |.|.|                                 |.:|
Mouse   431 EYRQEAGRELLIPCAAAGDPFPVITWRK---------------------------------VGKP 462

  Fly    95 STTATSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLIVRTVP 159
            |.:..:|..| .:||   .|.|..||.|:.|.|:           ...|..:.......::.|.|
Mouse   463 SRSKHNALPS-GSLQ---FRALSKEDHGEWECVA-----------TNVVTSITASTHLTVIGTSP 512

  Fly   160 GPVSQLYFKASTILGFLIWRFNKTQSGGYPVRSFTAEYRN------------VSYKTPPANASFE 212
            .....:....|.....:.|  .....|||. ::|:..|..            :|...||.     
Mouse   513 HAPGSVRVHVSMTTANVSW--EPGYDGGYE-QTFSVWYGPLMKRAQFGPHDWLSLSVPPG----- 569

  Fly   213 HAWSRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNELGS---GEVVTTNVTTLPETKEEDLIR 274
            .:|..:|              .|.|.|.|:|.:.|.|.||:   .||||.|....|.|..|.|:.
Mouse   570 PSWLLVD--------------SLEPETAYQFSVLAQNRLGTSAFSEVVTVNTLAFPVTTPEPLVL 620

  Fly   275 LIKP 278
            :..|
Mouse   621 VTPP 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 9/54 (17%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/7 (14%)
Ig strand F 84..89 CDD:409358 0/4 (0%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:409353
Ig strand B 43..47 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 98..102 CDD:409353
Ig strand F 112..117 CDD:409353
I-set 141..227 CDD:400151
Ig strand B 159..163 CDD:409353
Ig strand C 172..176 CDD:409353
Ig strand E 193..197 CDD:409353
Ig strand F 207..212 CDD:409353
Ig strand G 220..223 CDD:409353
Ig_3 230..309 CDD:464046
Ig 338..412 CDD:472250
Ig strand B 344..348 CDD:409353
Ig strand C 357..362 CDD:409353
Ig strand E 382..386 CDD:409353
Ig strand F 396..401 CDD:409353
Ig strand G 409..412 CDD:409353
Ig 431..507 CDD:472250 26/123 (21%)
Ig strand B 440..444 CDD:409353 1/3 (33%)
Ig strand C 453..457 CDD:409353 1/3 (33%)
Ig strand E 473..477 CDD:409353 2/6 (33%)
Ig strand F 487..492 CDD:409353 1/4 (25%)
FN3 <492..>737 CDD:442628 34/166 (20%)
Ig strand G 500..503 CDD:409353 0/2 (0%)
FN3 512..607 CDD:238020 26/116 (22%)
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.