DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Vsig10

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001028483.2 Gene:Vsig10 / 231668 MGIID:2448533 Length:558 Species:Mus musculus


Alignment Length:184 Identity:41/184 - (22%)
Similarity:60/184 - (32%) Gaps:69/184 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GGNVSIPCIAQG-----NIMWVK-------EHGNNSTIVQTGR--VLVLRNVS-TTDAGIYVCFA 89
            ||||::.|...|     .|.|::       :..::..|.|.|:  .|.:.|.| ..|.|.|.|.|
Mouse   342 GGNVTLTCEVSGANPPARIQWLRNLTQPAIQPSSHYIITQQGQSSSLTIHNCSQDLDEGFYYCQA 406

  Fly    90 -------------SVPRP----------------STTATSATT---SP------------QNLQD 110
                         ||..|                .....|..|   ||            |::.|
Mouse   407 ENLVGVRATNIWLSVKEPLNIGGIVGTVVSLLLLGLAVVSGLTLYYSPAFWWKGGSTFRGQDMGD 471

  Fly   111 KETRPLEDEDDGQGESVSPKDDQLKEAEME-EEVEYL---------AHQRTKLI 154
            .......:|::.:.|....|:|..:|.|.| .|.|.|         .|:.|.|:
Mouse   472 VMVLVDSEEEEEEEEEEEEKEDVAEEVEQETNETEELPKGISKHGHIHRVTALV 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 19/77 (25%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/3 (33%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Vsig10NP_001028483.2 IG_like 55..140 CDD:214653
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353
Ig strand E 107..111 CDD:409353
Ig strand F 121..125 CDD:409353
IG_like 160..240 CDD:214653
Ig strand B 170..174 CDD:409353
Ig strand C 183..187 CDD:409353
Ig strand E 208..212 CDD:409353
Ig strand F 218..223 CDD:409353
Ig strand G 232..235 CDD:409353
IG_like 341..421 CDD:214653 19/78 (24%)
Ig strand B 345..349 CDD:409353 1/3 (33%)
Ig strand C 359..363 CDD:409353 1/3 (33%)
Ig strand E 386..390 CDD:409353 1/3 (33%)
Ig strand F 401..406 CDD:409353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..515 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..558
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.