DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and Ncam1

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:446 Identity:85/446 - (19%)
Similarity:136/446 - (30%) Gaps:179/446 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NEYATDKGGNVSIPCIAQG----NIMW-----------------------------VKEHGNNST 64
            |:.|.:....|::.|.|.|    :|.|                             |:.|...|:
Mouse   316 NQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSS 380

  Fly    65 IVQTGRVLVLRNVSTTDAGIYVCFAS----------------VPR-------------------- 93
                   |.|:::..||||.|:|.||                .|:                    
Mouse   381 -------LTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCE 438

  Fly    94 ----PSTTAT---------SATTSPQNLQDK------ETRPLEDEDDGQGESVSPKDDQLKEAEM 139
                ||.|.:         |:..|...:.:.      |..|..:.|.|.....:      .....
Mouse   439 VFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTA------VNRIG 497

  Fly   140 EEEVEYLAHQRTKLIVRTVPGPVS----QLYFKASTILGFLIWRFNKTQ-SGGYPVRSFTAEYRN 199
            :|.:|::      |:....|...|    :.|...:.:      :|::.: :||.|:..:.||:::
Mouse   498 QESLEFI------LVQADTPSSPSIDRVEPYSSTAQV------QFDEPEATGGVPILKYKAEWKS 550

  Fly   200 VSYKTPPANASFEHAW-----SRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNELGSGEV-VT 258
            :      ...|:...|     :.|:.|        :.:..|.|.|.|..|:.|.|..|.||: ..
Mouse   551 L------GEESWHFKWYDAKEANMEGI--------VTIMGLKPETRYSVRLAALNGKGLGEISAA 601

  Fly   259 TNVTTLPETKEEDLIRLIKPDLDNFDPR--IWIVAVSIVLGTLVILAIGLCIVLSKECYQSAQME 321
            |...|.|......|.......|....||  .|.:.   ||.|         ..|||....:.::|
Mouse   602 TEFKTQPVHSPPPLAPANSSTLVPLSPRATTWPLP---VLPT---------TDLSKGEPSAPKLE 654

  Fly   322 LQDGWDSIELIPNIILNPGFSESDGG-------------------PE---PGGQGH 355
            .|.|.|...:..|:|     .:.|||                   ||   |.|..|
Mouse   655 GQMGEDGNSIKVNLI-----KQDDGGSPIRHYLVKYRAKLASEWKPEIRLPSGSDH 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 17/83 (20%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 2/32 (6%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353
Ig strand F 186..191 CDD:409353
IgI_3_NCAM-1 211..308 CDD:143207
Ig strand A 211..216 CDD:143207
Ig strand A' 220..226 CDD:143207
Ig strand B 229..239 CDD:143207
Ig strand C 243..249 CDD:143207
Ig strand C' 251..253 CDD:143207
Ig strand D 263..266 CDD:143207
Ig strand E 271..277 CDD:143207
Ig strand F 283..292 CDD:143207
Ig strand G 295..307 CDD:143207
IgI_NCAM-1 307..413 CDD:143277 21/103 (20%)
Ig strand A 307..312 CDD:143277
Ig strand A' 316..320 CDD:143277 1/3 (33%)
Ig strand B 325..333 CDD:143277 2/7 (29%)
Ig strand C 339..345 CDD:143277 2/5 (40%)
Ig strand C' 348..351 CDD:143277 0/2 (0%)
Ig strand D 369..375 CDD:143277 1/5 (20%)
Ig strand E 378..384 CDD:143277 2/12 (17%)
Ig strand F 392..400 CDD:143277 4/7 (57%)
Ig strand G 403..413 CDD:143277 0/9 (0%)
IG_like 422..500 CDD:214653 9/83 (11%)
Ig strand B 433..437 CDD:409353 0/3 (0%)
Ig strand C 446..450 CDD:409353 1/3 (33%)
Ig strand E 473..477 CDD:409353 0/3 (0%)
Ig strand F 487..492 CDD:409353 0/4 (0%)
fn3 512..599 CDD:394996 22/106 (21%)
fn3 649..731 CDD:394996 14/62 (23%)
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.