DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and ncam1b

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_009289824.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1054 Species:Danio rerio


Alignment Length:332 Identity:66/332 - (19%)
Similarity:101/332 - (30%) Gaps:125/332 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFFTQVLTVLSSTIKYNEYATDKGGNVSIPCIAQGN----IMW--------VKEHGNNSTIVQT- 68
            :|....:|.|.|     :..|:....|::.|.|.|:    |.|        ..|......|.|. 
Zfish   298 VFVQPKITYLES-----QTTTEMDEQVTLTCEATGDPTPTITWSFGTRVFTEGEQEQQKRIYQAS 357

  Fly    69 -----------GRVLV----------LRNVSTTDAGIYVCFASVPRPSTTATSATTSPQNLQDKE 112
                       |.|||          |:....||||.|:|.|      ..|...|..|.:|:.:.
Zfish   358 WTRPEQHKGPDGEVLVRSDARVSSLTLKYPQYTDAGQYLCTA------RNAIGETVQPVSLEVRY 416

  Fly   113 TRPLEDED-----DGQGESVS------PKDDQLK---------------------------EAEM 139
            ...:....     :|...::|      |.|..:.                           |...
Zfish   417 APKILGSVAVYTWEGNPANISCEVLAHPSDVSITWLRDGFQLPNANTSNIKIHNTPSASYLEVNP 481

  Fly   140 EEEVEYLAHQRTK------------LIVRTVPGPVS----QLYFKASTILGFLIWRFNKTQS-GG 187
            |.:.::..:..|.            :|...||...|    |.|...:.:|      |.:.:| ||
Zfish   482 ESQSDFGNYNCTTSNEIGTESREFIMIPADVPSAPSIGEVQPYSSTAQVL------FEEPESTGG 540

  Fly   188 YPVRSFTAEYRNVSYKTPPANASFEHAWSRMDPINIAFNVR----QMEVYRLAPNTTYEFRIWAN 248
            .||..:.||:|.|.          ...|     :...:.|:    .:.|..|.|.|.||.::.|.
Zfish   541 VPVLKYRAEWRAVG----------RGKW-----VQRVYEVKDGLSSVTVTGLKPETDYEVKMSAI 590

  Fly   249 NELGSGE 255
            |..|.|:
Zfish   591 NGKGEGD 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 20/84 (24%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 2/15 (13%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
ncam1bXP_009289824.1 Ig 20..113 CDD:472250
Ig strand B 37..41 CDD:409353
Ig strand C 49..53 CDD:409353
Ig strand E 77..81 CDD:409353
Ig strand F 91..96 CDD:409353
Ig strand G 104..107 CDD:409353
Ig 117..186 CDD:472250
Ig strand B 132..136 CDD:409353
Ig strand C 145..149 CDD:409353
Ig strand E 169..173 CDD:409353
Ig strand F 183..188 CDD:409353
Ig strand G 198..201 CDD:409353
Ig 208..301 CDD:472250 1/2 (50%)
Ig strand B 228..232 CDD:409353
Ig strand C 241..245 CDD:409353
Ig strand E 264..268 CDD:409353
Ig strand F 278..283 CDD:409353
Ig strand G 291..294 CDD:409353
Ig 300..414 CDD:472250 29/124 (23%)
Ig strand B 319..323 CDD:409353 1/3 (33%)
Ig strand C 332..336 CDD:409353 1/3 (33%)
Ig strand E 380..384 CDD:409353 0/3 (0%)
Ig strand F 394..399 CDD:409353 2/4 (50%)
Ig strand G 407..410 CDD:409353 0/2 (0%)
IG_like 426..505 CDD:214653 7/78 (9%)
Ig strand B 434..438 CDD:409353 0/3 (0%)
Ig strand C 448..452 CDD:409353 0/3 (0%)
Ig strand E 475..479 CDD:409353 0/3 (0%)
Ig strand F 489..494 CDD:409353 0/4 (0%)
FN3 513..606 CDD:238020 27/106 (25%)
fn3 642..712 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.